Inn on Broadway
Hotel en Brighton, NY
Hotel de 3 estrellas
Razones para reservar
Buen precio para esta ubicaciónLos precios de las propiedades en esta área son generalmente más altos
Incluye lo esencialAire acondicionado, Internet/WiFi, Aparcamiento y más
Reserva con confianzaColaboramos con los principales sitios web de viajes para que estés seguro de que estás obteniendo una buena oferta de alquiler perfecto.
Sobre este hotel
Inn on Broadway
Hotel de gran confort de estilo georgiano a pocos pasos de Strong
Además de un restaurante, este hotel para no fumadores cuenta con un bar o lounge y un centro de negocios disponible las 24 horas. Podrás disfrutar de un desayuno continental gratuito, wifi gratis en las zonas comunes y aparcamiento con asistencia gratuito. También encontrarás café o té en las zonas comunes, un centro de negocios y una zona para conferencias.
Se ofrece un servicio de limpieza a petición.
Inn on Broadway ofrece 25 alojamientos con aire acondicionado, botella de agua gratuita y cafetera y tetera. Cada alojamiento tiene un mobiliario y decoración diferentes. Las camas están vestidas con edredón de plumas y ropa de cama de alta calidad. Se ofrece una televisión de pantalla plana de 32 pulgadas con canales por cable. Los baños están dotados de albornoces, artículos de higiene personal de diseño, artículos de higiene personal gratuitos y secador de pelo.
Además de un restaurante, este hotel para no fumadores cuenta con un bar o lounge y un centro de negocios disponible las 24 horas. Podrás disfrutar de un desayuno continental gratuito, wifi gratis en las zonas comunes y aparcamiento con asistencia gratuito. También encontrarás café o té en las zonas comunes, un centro de negocios y una zona para conferencias.
Se ofrece un servicio de limpieza a petición.
Inn on Broadway ofrece 25 alojamientos con aire acondicionado, botella de agua gratuita y cafetera y tetera. Cada alojamiento tiene un mobiliario y decoración diferentes. Las camas están vestidas con edredón de plumas y ropa de cama de alta calidad. Se ofrece una televisión de pantalla plana de 32 pulgadas con canales por cable. Los baños están dotados de albornoces, artículos de higiene personal de diseño, artículos de higiene personal gratuitos y secador de pelo.
Este hotel en Rochester ofrece acceso a Internet por cable y wifi gratis. Los servicios para las personas de negocios incluyen escritorio y teléfono; se ofrecen llamadas locales gratuitas (pueden existir restricciones). Es posible solicitar cambio de toallas y cambio de sábanas. Se ofrece servicio nocturno de descubierta y servicio de limpieza a petición.
Servicios
Aire acondicionado
Internet/WiFi
Aparcamiento
TV
Mapa de Brighton, NY
Habitaciones Disponibles
Traditional Room
1 Cama tamaño queen
Capacidad para alojar 3
Serás dirigido a Expedia.com para consultar disponibilidad y precios.
Deluxe Room
1 Cama king size
Capacidad para alojar 2
Serás dirigido a Expedia.com para consultar disponibilidad y precios.
Luxury Room, 1 King Bed, Fireplace
1 Cama king size
Capacidad para alojar 2
Serás dirigido a Expedia.com para consultar disponibilidad y precios.
€€€€
Valoraciones y reseñas
2.5 / 5.0
I liked this historic hotel but liked the staff even more. They were top tier in professionalism and made me feel special and right at home. A local friend met me for dinner. The bartender was so great we decided to eat at the bar instead of going into the restaurant. The dinner was absolutely gorgeous and so delish!
2.0 / 5.0
This hotel started life as a university club in the 1920's and has tried to maintain the same character except for improved amenities. They have added, for example, a USB port or two in each room, and a more modern elevator. Most of the furniture are antiques, maintained in very good condition. The bed was OK. The breakfast was not - it consisted of coffee, tea, a muffin, a granola bar, and perhaps a banana. To be precise, they did not refer to it as breakfast, but instead as guest snacks. The restaurant was decorated with lots of "art" - most of the quality you might expect from college art students (this was, after all, almost adjacent to the University of Rochester), and most of those rather depressing. However, there were two large jade carvings in the center of the room that were excellent.
We mostly got along well there although I had expected something more in the way of breakfast. Apparently, though, the hotel advertisement did not really mention breakfast - I must have assumed it since this hotel showed up in the listings when I had specified only hotels with breakfast included. Oh well.
2.5 / 5.0
Everything was great. If I were to add one thing . . . a muffin and coffee for breakfast was fine . . . perhaps some orange juice would be a nice addition.
5.0 / 5.0
The location on relation to our destination was perfect. The hotel itself was very quaint and homey.
4.0 / 5.0
They mentioned breakfast is included. Not true. It was only coffee (I had to asked for that too) and muffin. Oh, there were only two dried small oranges. That's all. Do not get fooled by that posting. Other than that was not bad
2.0 / 5.0
The Inn was very nice and we enjoyed the tavern. Our room was clean and comfortable but missing some things. Door moldings are knicked and smudged. But, it’s a 100 year old building and we love those buildings. Staff was great. Highly recommend. Parking was ample and adjacent to the hotel.
5.0 / 5.0
Beautiful property with great staff.
2.5 / 5.0
Lovely boutique hotel close to the Eastman School of Music. Perfect for getting my son settled in his dorm room.
5.0 / 5.0
Quaint and convenient location!
4.0 / 5.0
Not well thought out; no desk in room and side chair losing its seat. Breakfast was a joke. Bed had metal tassels that could cause injury if not carefully avoided.
2.0 / 5.0
Very nice old hotel. Charming and quaint. Very no frills. People at front desk were excellent
2.5 / 5.0
Great restaurant historic building filled with Ramon Santiago art!
5.0 / 5.0
Clean, classic and intimate hotel.
5.0 / 5.0
I love the nostalgia of stepping back in time to the 1920s. It says breakfast is included in stay, but it is a couple of pastries, some fruit and coffee in the lobby that was gone when we checked in the morning.
4.0 / 5.0
I stayed in two different rooms during my time there. The corner room for my wedding night was beautiful, well decorated and very clean. I will definitely go there again.
2.0 / 5.0
Hotel is nice. Historic. One room was decorated in a historic style, one was quite plain. The room was fine, only a double bed not a queen. Only set for one person (one coffee pod, one robe) so you would have to call for more supplies. The towels were extremely tough, like they were dried on a line? The bed was comfy. Mostly the disappointing thing was that the "breakfast included" was no name plain instant oatmeal with tepid water, one old orange and a couple of muffins. We didn't dare try the coffee. That was the spread in the lobby for all of the guests. Why advertise "breakfast included" at all? "Limited complimentary snacks" would not have triggered this mediocre review.
5.0 / 5.0
The Inn on Broadway is a great boutique hotel in downtown Rochester. The room was clean and spacious. Guest services were helpful and informative. Highly recommend.
2.5 / 5.0
The Inn on Broadway is located in downtown Rochester and is a historic landmark. It was a comfortable place to stay with modern amenities.
5.0 / 5.0
Wonderful, old building with a lot of neat quirks. Had a small suite that was very comfortable. The staff was very friendly and accommodating. Would definitely stay here again.
1.0 / 5.0
Bathroom sink backed up after turning on faucet for 5 seconds. Was unable to control the HVAC in the room.
2.5 / 5.0
Pleasant historic appearing hotel in the heart of Rochester. Very comfortable. Restaurant excellent. We were there on a Sunday so it was quiet. We would return.
2.0 / 5.0
The restaurant was five star Michelin quality. The hotel had some old charm but was in need of updating badly.
The king size bed was too high. The windows were not able to be opened with a sign to that effect. Soundproofing was not good from next room. There was no venting fan for bathroom. There was a glass shelf above the sink which was perilous for items and especially the two beautiful crystal glasses placed there. There were no cream/sugars,stirers for coffee and only two coffees for two people. Very disappointing. Breakfast was a standup bar with muffins, protein bars, and coffee/tea. No service in dining room!
To top off our stay, the toilet didn't flush properly in the morning and no maintenance man was available immediately or even after more than one-half hour. Luckily there was bathroom just down the hall for disabled and available. I would never recommend this hotel.
2.5 / 5.0
I have stayed here several times, always during the Rochester Jazz Festival. The location is perfect, the city very walkable. An aged hotel with personality, and a staff both outstanding and friendly too. A perfect place to start a visit, event or a place to eat. Their restaurant was very good. A- only because something can always be better right?
5.0 / 5.0
Enjoyed our stay.
5.0 / 5.0
Great
3.0 / 5.0
Location of the Inn was exactly what we were looking for. It was in walking distance to all the jazz festival venues. The bathroom was updated and awesome. Multi headed shower with temperature gauge! However towels were hard/uncomfortable. Free continental Breakfast for the price we paid for the room was disappointing as well. No coffee oatmeal or napkins, and day old muffins the first morning we were there. This was just after 7:10 when breakfast was supposed to be available (at 7).
5.0 / 5.0
We love the Inn on Broadway. It's a beautiful building with great amenities and outstanding staff. The shower is awesome too. Convenient to anything happening downtown. This is our go-to for Jazz fest etc.
3.0 / 5.0
Coffee bar in downstairs lobby was not consistently maintained. Ran out in afternoon. One morning, no coffee available at 5:50 am, or when I returned at 6:10. Plenty of people are looking for more than room coffee at 6:10 in the morning. Where's the staff on this?
1.5 / 5.0
The hotel is older and there was a lot of renovation going on. Our room did not have a table and desk for working on a laptop. This was problematic. The toilet mad a horrible banging noise when flushed. The towels were not soft and it’s impossible to read the small print on the soap and shampoo bottle if you’re not wearing your glasses. Who wears glasses when they shower? The staff is super friendly and helpful but they are often not at the front desk and totally missing when we needed to check out. The hotel is in a good location and they have a cozy bar tucked away with a very friendly bartender.
3.0 / 5.0
Very slow service at the restaurant, confusion with the orders and billing. The food was over cooked.
2.5 / 5.0
Friendly staff, clean & cozy rooms, and great lounge atmosphere.
4.0 / 5.0
The only problem with the property was that the television was not working. When I went to explain this to the front desk, they said they would fix it. I was gone for four hours and came back and it was never fixed.
4.0 / 5.0
All was good. Only complaint is in the bathroom. There is no nonslip stripes in the tub. Be very careful not to slip in the shower.
5.0 / 5.0
Good!
5.0 / 5.0
I love the area, very clean spot to stay
4.0 / 5.0
In traveling I am very particular about comfort of the bed, and I was not disappointed. Had a very good sleep. We walked around then went to the bar at the hotel… the calamari and crab cake were delicious. A nice just right ending to a long day. The staff was very friendly and Adam was great, very friendly and lights up the atmosphere. Overall the hotel was great, would stay here again !!
5.0 / 5.0
The price was reasonable, and I somewhat expected a hotel that this may be a little tired and not at the best condition what I found was a hotel that was a freshly renovated was bathroom that was modern But respecting the old-fashioned character of the place, so even though things were knew They were respecting traditional style. The room was spacious and well appointed with enough plugs, and the bed was fairly comfortable, except that the edges were overly hard and raised, and let us to slide to the centre a bit. That would be probably my main complaint in a place that was actually very good and interaction with the receptionist was very positive as well
3.0 / 5.0
Unfortunately there was no water in the building when we arrived. It was back on upon our return from our show however which was greatly appreciated.
5.0 / 5.0
I loved the historic charm and decor of the property. Plenty of onsite free parking, bar and restaurant on site, and wonderful robe for after my shower. We did have to go to the bar to get ice and a drink as there are no ice or vending machines but it was not a problem. The bathroom had a slightly odd configuration with the sink and mirror in the corner and it was rather small but it worked. Would definitely recommend and this will be our spot for our annual trip to Rochester.
3.0 / 5.0
Needs more cleaning, v old carpeting, cheap towels
Preguntas frecuentes
¿Cuánto cuesta alquilar este hotel en comparación con otros en Brighton?
El precio medio de un alquiler en Brighton es 144 € por noche. Este alquiler es 24 € más elevado que la media.
¿Este hotel incluye aparcamiento?
Sí, Inn on Broadway incluye aparcamiento. Para más información, contacta directamente con el alojamiento.
¿hotel cuenta con piscina?
hotel no cuenta con piscina en sus instalaciones. A lo mejor quieres reconsiderar si la piscina es importante para tu estancia.
¿Inn on Broadway admite mascotas?
Lamentablemente, este hotel no admite mascotas. Intente buscar de nuevo y filtre por "Se admiten mascotas"
¿Qué comodidades están disponibles en Inn on Broadway?
Hemos encontrado 4 comodidades para este alquiler. Esto incluye aire acondicionado, internet/wifi, aparcamiento y tv.
Explore alquileres de vacaciones en Brighton
Descubre todos los alquileres en Brighton
Country Inn & Suites by Radisson, Rochester-Pittsford-Brighton, NY
Hotel
3estrella
1 cama tamaño extragrande
Cocina o cocina pequeña · Aire acondicionado · Internet/WiFi
Más guardado en favoritos
€€€€
Motel 6 Rochester - Airport
Hotel
2estrella
1 cama tamaño extragrande
Se aceptan mascotas · Aire acondicionado · Internet/WiFi
€€€€
Inn on Broadway
Posada
1 cama doble
Cocina o cocina pequeña · Aire acondicionado · Internet/WiFi
€€€€
Red Roof Inn Rochester - Airport
Motel
2 camas de matrimonio
Se aceptan mascotas · Cocina o cocina pequeña · Aire acondicionado
Más guardado en favoritos
€€€€
Hilton Garden Inn Rochester - University & Medical Center
Hotel
3estrella
1 cama tamaño extragrande
Piscina · Se aceptan mascotas · Cocina o cocina pequeña
Más guardado en favoritos
€€€€
Quality Inn
Posada
2 camas de matrimonio
Se aceptan mascotas · Cocina o cocina pequeña · Aire acondicionado
Más guardado en favoritos
€€€€
School 31 Lofts
Apartahotel
1 cama tamaño extragrande
Jardín · Se aceptan mascotas · Cocina o cocina pequeña
Más guardado en favoritos
€€€€
Hyatt Regency Rochester
Hotel
4estrella
1 cama tamaño extragrande
Piscina · Se aceptan mascotas · Cocina o cocina pequeña
€€€€
Staybridge Suites Rochester University, an IHG Hotel
Hotel
3estrella
1 cama de matrimonio, 1 sofa bed
Se aceptan mascotas · Cocina o cocina pequeña · Aire acondicionado
€€€€
Best Western Inn at the Rochester Airport
Hotel
3estrella
1 cama tamaño extragrande
Cocina o cocina pequeña · Aire acondicionado · Internet/WiFi
€€€€
Dartmouth House
Posada
1 cama tamaño extragrande
Cocina o cocina pequeña · Aire acondicionado · Internet/WiFi
€€€€
Spark By Hilton Rochester University Area
Hotel
3estrella
1 cama tamaño extragrande
Piscina · Cocina o cocina pequeña · Aire acondicionado
€€€€
Fairfield Inn Rochester Airport
Hotel
3estrella
1 cama tamaño extragrande
Aire acondicionado · Internet/WiFi · Aparcamiento
€€€€
Hilton Garden Inn Rochester Downtown, NY
Hotel
3estrella
1 cama tamaño extragrande
Piscina · Se aceptan mascotas · Cocina o cocina pequeña
€€€€
The Strathallan - a DoubleTree by Hilton
Hotel
4estrella
1 cama tamaño extragrande
Jardín · Piscina · Cocina o cocina pequeña
€€€€
Courtyard Rochester Brighton
Hotel
3estrella
1 cama tamaño extragrande
Piscina · Cocina o cocina pequeña · Aire acondicionado
€€€€
Holiday Inn Express Rochester - University Area, an IHG Hotel
Hotel
3estrella
1 single bed
Piscina · Cocina o cocina pequeña · Aire acondicionado
€€€€
Airport, Eastman Dental, UofR & Medical Ctr at Strong Hospital-Professionals Welcomed
Alojamiento y desayuno
Cocina o cocina pequeña · Aire acondicionado · Internet/WiFi
€€€€
Convenient, Pet-Friendly Rochester Vacation Rental
Casa
Se aceptan mascotas · Cocina o cocina pequeña · Aire acondicionado
€€€€
1bed-equippedkitchendttvhighfalls-wifi
Apartamento
Se aceptan mascotas · Cocina o cocina pequeña · Aire acondicionado
€€€€
1bedequippedkitchen-highfalls,tv,dt-wi-fi
Casa
Se aceptan mascotas · Cocina o cocina pequeña · Aire acondicionado
€€€€
ABODES ApartHotel
Apartamento
Se aceptan mascotas · Cocina o cocina pequeña · Aire acondicionado
€€€€
Charming Family Retreat- Cozy Comfort Awaits You! home
Casa
Cocina o cocina pequeña · Aire acondicionado · Internet/WiFi
€€€€
Apartment Near UofR Strong Airport and DWTN
Apartamento
Cocina o cocina pequeña · Aire acondicionado · Internet/WiFi
€€€€
Home Theater Suite in Park Ave Neighborhood
Apartamento
Jardín · Se aceptan mascotas · Cocina o cocina pequeña
€€€€
Hampton Inn & Suites Rochester Downtown
Hotel
3estrella
1 cama tamaño extragrande
Piscina · Cocina o cocina pequeña · Aparcamiento
€€€€
Nuevo en VacationRenter
Beautifully Renovated 4B Single Family Brighton Sleeps 9 Pets Welcome
Casa
Jardín · Se aceptan mascotas · Cocina o cocina pequeña
€€€€
NY Style Centric Loft with King Bed by Park ave
Apartamento
Se aceptan mascotas · Cocina o cocina pequeña · Aire acondicionado
€€€€
Nuevo en VacationRenter
Brighton 5th Floor Condo with Resort Amenities
Apartamento
Piscina · Se aceptan mascotas · Cocina o cocina pequeña
€€€€