Inn on Broadway
Hôtel à Brighton, NY
Hôtel 3 étoiles
Raisons de réserver
Prix raisonnable pour cet endroitLes prix de l'immobilier dans cette zone sont généralement plus élevés
Comprend les essentielsClimatisation, Internet/Wi-Fi, Parking et plus
Réservez en toute confianceNous travaillons en partenariat avec les meilleurs sites de voyage pour que vous obteniez une bonne affaire sur la location parfaite.
A propos de ce hôtel
Inn on Broadway
Hôtel tout confort de style géorgien, à distance de marche de Strong
Outre le fait d'être non-fumeurs, cet hôtel a aussi l'avantage de proposer un restaurant, un bar / salon et un centre d'affaires ouvert 24 h/24. Le petit-déjeuner continental gratuit, le Wi-Fi gratuit dans les parties communes et le parking gratuit avec voiturier sont également fournis. Également sur place, vous trouverez du café/thé dans les espaces communs, un centre d'affaires et un espace de conférence.
Le service d'entretien est disponible sur demande
Inn on Broadway possède 25 chambres comprenant la climatisation, de l'eau minérale (offerte) et une cafetière ou une bouilloire. Chaque chambre bénéficie d'une décoration et d'un ameublement personnalisés. Linge de lit avec une couette en duvet d'oie et de la literie de qualité supérieure. Une télévision à écran plat 32 pouces donne accès aux chaînes par câble. Les salles de bain comprennent des peignoirs, des articles de toilette de luxe, des articles de toilette gratuits et un sèche-cheveux.
Outre le fait d'être non-fumeurs, cet hôtel a aussi l'avantage de proposer un restaurant, un bar / salon et un centre d'affaires ouvert 24 h/24. Le petit-déjeuner continental gratuit, le Wi-Fi gratuit dans les parties communes et le parking gratuit avec voiturier sont également fournis. Également sur place, vous trouverez du café/thé dans les espaces communs, un centre d'affaires et un espace de conférence.
Le service d'entretien est disponible sur demande
Inn on Broadway possède 25 chambres comprenant la climatisation, de l'eau minérale (offerte) et une cafetière ou une bouilloire. Chaque chambre bénéficie d'une décoration et d'un ameublement personnalisés. Linge de lit avec une couette en duvet d'oie et de la literie de qualité supérieure. Une télévision à écran plat 32 pouces donne accès aux chaînes par câble. Les salles de bain comprennent des peignoirs, des articles de toilette de luxe, des articles de toilette gratuits et un sèche-cheveux.
Cet hôtel de Rochester offre l'accès gratuit à Internet Wi-Fi et câblé. Parmi les services d'affaires, les chambres comprennent des bureaux et un téléphone ; vous pouvez passer des appels locaux gratuits (sous réserve de certaines restrictions). Le remplacement des serviettes et le remplacement des draps sont disponibles sur demande. Un service de préparation de lit en soirée est fourni, et un service de ménage est proposé sur demande.
Équipements
Climatisation
Internet/Wi-Fi
Parking
TV
Carte de Brighton, NY
Chambres disponibles
Traditional Room
1 Lit queen-size
Capacité d'accueil 3
Vous serez dirigé vers Expedia.com pour connaître la disponibilité et les tarifs.
Deluxe Room
1 Lit King Size
Capacité d'accueil 2
Vous serez dirigé vers Expedia.com pour connaître la disponibilité et les tarifs.
Luxury Room, 1 King Bed, Fireplace
1 Lit King Size
Capacité d'accueil 2
Vous serez dirigé vers Expedia.com pour connaître la disponibilité et les tarifs.
€€€€
Avis
2.5
I liked this historic hotel but liked the staff even more. They were top tier in professionalism and made me feel special and right at home. A local friend met me for dinner. The bartender was so great we decided to eat at the bar instead of going into the restaurant. The dinner was absolutely gorgeous and so delish!
2.0
This hotel started life as a university club in the 1920's and has tried to maintain the same character except for improved amenities. They have added, for example, a USB port or two in each room, and a more modern elevator. Most of the furniture are antiques, maintained in very good condition. The bed was OK. The breakfast was not - it consisted of coffee, tea, a muffin, a granola bar, and perhaps a banana. To be precise, they did not refer to it as breakfast, but instead as guest snacks. The restaurant was decorated with lots of "art" - most of the quality you might expect from college art students (this was, after all, almost adjacent to the University of Rochester), and most of those rather depressing. However, there were two large jade carvings in the center of the room that were excellent.
We mostly got along well there although I had expected something more in the way of breakfast. Apparently, though, the hotel advertisement did not really mention breakfast - I must have assumed it since this hotel showed up in the listings when I had specified only hotels with breakfast included. Oh well.
2.5
Everything was great. If I were to add one thing . . . a muffin and coffee for breakfast was fine . . . perhaps some orange juice would be a nice addition.
5.0
The location on relation to our destination was perfect. The hotel itself was very quaint and homey.
4.0
They mentioned breakfast is included. Not true. It was only coffee (I had to asked for that too) and muffin. Oh, there were only two dried small oranges. That's all. Do not get fooled by that posting. Other than that was not bad
2.0
The Inn was very nice and we enjoyed the tavern. Our room was clean and comfortable but missing some things. Door moldings are knicked and smudged. But, it’s a 100 year old building and we love those buildings. Staff was great. Highly recommend. Parking was ample and adjacent to the hotel.
5.0
Beautiful property with great staff.
2.5
Lovely boutique hotel close to the Eastman School of Music. Perfect for getting my son settled in his dorm room.
5.0
Quaint and convenient location!
4.0
Not well thought out; no desk in room and side chair losing its seat. Breakfast was a joke. Bed had metal tassels that could cause injury if not carefully avoided.
2.0
Very nice old hotel. Charming and quaint. Very no frills. People at front desk were excellent
2.5
Great restaurant historic building filled with Ramon Santiago art!
5.0
Clean, classic and intimate hotel.
5.0
I love the nostalgia of stepping back in time to the 1920s. It says breakfast is included in stay, but it is a couple of pastries, some fruit and coffee in the lobby that was gone when we checked in the morning.
4.0
I stayed in two different rooms during my time there. The corner room for my wedding night was beautiful, well decorated and very clean. I will definitely go there again.
2.0
Hotel is nice. Historic. One room was decorated in a historic style, one was quite plain. The room was fine, only a double bed not a queen. Only set for one person (one coffee pod, one robe) so you would have to call for more supplies. The towels were extremely tough, like they were dried on a line? The bed was comfy. Mostly the disappointing thing was that the "breakfast included" was no name plain instant oatmeal with tepid water, one old orange and a couple of muffins. We didn't dare try the coffee. That was the spread in the lobby for all of the guests. Why advertise "breakfast included" at all? "Limited complimentary snacks" would not have triggered this mediocre review.
5.0
The Inn on Broadway is a great boutique hotel in downtown Rochester. The room was clean and spacious. Guest services were helpful and informative. Highly recommend.
2.5
The Inn on Broadway is located in downtown Rochester and is a historic landmark. It was a comfortable place to stay with modern amenities.
5.0
Wonderful, old building with a lot of neat quirks. Had a small suite that was very comfortable. The staff was very friendly and accommodating. Would definitely stay here again.
1.0
Bathroom sink backed up after turning on faucet for 5 seconds. Was unable to control the HVAC in the room.
2.5
Pleasant historic appearing hotel in the heart of Rochester. Very comfortable. Restaurant excellent. We were there on a Sunday so it was quiet. We would return.
2.0
The restaurant was five star Michelin quality. The hotel had some old charm but was in need of updating badly.
The king size bed was too high. The windows were not able to be opened with a sign to that effect. Soundproofing was not good from next room. There was no venting fan for bathroom. There was a glass shelf above the sink which was perilous for items and especially the two beautiful crystal glasses placed there. There were no cream/sugars,stirers for coffee and only two coffees for two people. Very disappointing. Breakfast was a standup bar with muffins, protein bars, and coffee/tea. No service in dining room!
To top off our stay, the toilet didn't flush properly in the morning and no maintenance man was available immediately or even after more than one-half hour. Luckily there was bathroom just down the hall for disabled and available. I would never recommend this hotel.
2.5
I have stayed here several times, always during the Rochester Jazz Festival. The location is perfect, the city very walkable. An aged hotel with personality, and a staff both outstanding and friendly too. A perfect place to start a visit, event or a place to eat. Their restaurant was very good. A- only because something can always be better right?
5.0
Enjoyed our stay.
5.0
Great
3.0
Location of the Inn was exactly what we were looking for. It was in walking distance to all the jazz festival venues. The bathroom was updated and awesome. Multi headed shower with temperature gauge! However towels were hard/uncomfortable. Free continental Breakfast for the price we paid for the room was disappointing as well. No coffee oatmeal or napkins, and day old muffins the first morning we were there. This was just after 7:10 when breakfast was supposed to be available (at 7).
5.0
We love the Inn on Broadway. It's a beautiful building with great amenities and outstanding staff. The shower is awesome too. Convenient to anything happening downtown. This is our go-to for Jazz fest etc.
3.0
Coffee bar in downstairs lobby was not consistently maintained. Ran out in afternoon. One morning, no coffee available at 5:50 am, or when I returned at 6:10. Plenty of people are looking for more than room coffee at 6:10 in the morning. Where's the staff on this?
1.5
The hotel is older and there was a lot of renovation going on. Our room did not have a table and desk for working on a laptop. This was problematic. The toilet mad a horrible banging noise when flushed. The towels were not soft and it’s impossible to read the small print on the soap and shampoo bottle if you’re not wearing your glasses. Who wears glasses when they shower? The staff is super friendly and helpful but they are often not at the front desk and totally missing when we needed to check out. The hotel is in a good location and they have a cozy bar tucked away with a very friendly bartender.
3.0
Very slow service at the restaurant, confusion with the orders and billing. The food was over cooked.
2.5
Friendly staff, clean & cozy rooms, and great lounge atmosphere.
4.0
The only problem with the property was that the television was not working. When I went to explain this to the front desk, they said they would fix it. I was gone for four hours and came back and it was never fixed.
4.0
All was good. Only complaint is in the bathroom. There is no nonslip stripes in the tub. Be very careful not to slip in the shower.
5.0
Good!
5.0
I love the area, very clean spot to stay
4.0
In traveling I am very particular about comfort of the bed, and I was not disappointed. Had a very good sleep. We walked around then went to the bar at the hotel… the calamari and crab cake were delicious. A nice just right ending to a long day. The staff was very friendly and Adam was great, very friendly and lights up the atmosphere. Overall the hotel was great, would stay here again !!
5.0
The price was reasonable, and I somewhat expected a hotel that this may be a little tired and not at the best condition what I found was a hotel that was a freshly renovated was bathroom that was modern But respecting the old-fashioned character of the place, so even though things were knew They were respecting traditional style. The room was spacious and well appointed with enough plugs, and the bed was fairly comfortable, except that the edges were overly hard and raised, and let us to slide to the centre a bit. That would be probably my main complaint in a place that was actually very good and interaction with the receptionist was very positive as well
3.0
Unfortunately there was no water in the building when we arrived. It was back on upon our return from our show however which was greatly appreciated.
5.0
I loved the historic charm and decor of the property. Plenty of onsite free parking, bar and restaurant on site, and wonderful robe for after my shower. We did have to go to the bar to get ice and a drink as there are no ice or vending machines but it was not a problem. The bathroom had a slightly odd configuration with the sink and mirror in the corner and it was rather small but it worked. Would definitely recommend and this will be our spot for our annual trip to Rochester.
3.0
Needs more cleaning, v old carpeting, cheap towels
FAQ
Combien coûte ce hôtel par rapport aux autres à Brighton ?
Le prix moyen d’une location à Brighton est de 144 € par nuit. Cette location est 24 € au-dessus de la moyenne.
Le stationnement est-il inclus dans ce hôtel ?
Oui, le parking est répertorié comme un équipement pour Inn on Broadway. Pour plus d’informations, nous vous recommandons de contacter l’établissement pour savoir où vous garer.
Y a-t-il une piscine dans ce hôtel ?
Nous n’avons pas trouvé de piscine répertoriée comme équipement pour ce hôtel. Voulez-vous vraiment une piscine ?
La location Inn on Broadway accepte-t-elle les animaux ?
Malheureusement, ce hôtel n'est pas adapté aux animaux de compagnie. Essayez de refaire une recherche et filtrez pour "Animaux autorisés".
Quels équipements offre Inn on Broadway?
Nous avons trouvé 4 équipements pour cette location. Cela inclut climatisation, internet/wi-fi, parking et tv.
Explorez locations de vacances similaires à Brighton
Explorez toutes les locations à Brighton
Country Inn & Suites by Radisson, Rochester-Pittsford-Brighton, NY
Hôtel
3-étoile
1 lit king
Cuisine ou coin cuisine · Climatisation · Internet/Wi-Fi
Les plus marqués en favoris
€€€€
Motel 6 Rochester - Airport
Hôtel
2-étoile
1 lit king
Animaux de compagnie acceptés · Climatisation · Internet/Wi-Fi
€€€€
Inn on Broadway
Auberge
1 lit double
Cuisine ou coin cuisine · Climatisation · Internet/Wi-Fi
€€€€
Red Roof Inn Rochester - Airport
Motel
2 lits queen
Animaux de compagnie acceptés · Cuisine ou coin cuisine · Climatisation
Les plus marqués en favoris
€€€€
Hilton Garden Inn Rochester - University & Medical Center
Hôtel
3-étoile
1 lit king
Piscine · Animaux de compagnie acceptés · Cuisine ou coin cuisine
Les plus marqués en favoris
€€€€
Quality Inn
Auberge
2 lits queen
Animaux de compagnie acceptés · Cuisine ou coin cuisine · Climatisation
Les plus marqués en favoris
€€€€
School 31 Lofts
Appart-hôtel
1 lit king
Jardin · Animaux de compagnie acceptés · Cuisine ou coin cuisine
Les plus marqués en favoris
€€€€
Hyatt Regency Rochester
Hôtel
4-étoile
1 lit king
Piscine · Animaux de compagnie acceptés · Cuisine ou coin cuisine
€€€€
Staybridge Suites Rochester University, an IHG Hotel
Hôtel
3-étoile
1 lit queen, 1 sofa bed
Animaux de compagnie acceptés · Cuisine ou coin cuisine · Climatisation
€€€€
Best Western Inn at the Rochester Airport
Hôtel
3-étoile
1 lit king
Cuisine ou coin cuisine · Climatisation · Internet/Wi-Fi
€€€€
Dartmouth House
Auberge
1 lit king
Cuisine ou coin cuisine · Climatisation · Internet/Wi-Fi
€€€€
Spark By Hilton Rochester University Area
Hôtel
3-étoile
1 lit king
Piscine · Cuisine ou coin cuisine · Climatisation
€€€€
Fairfield Inn Rochester Airport
Hôtel
3-étoile
1 lit king
Climatisation · Internet/Wi-Fi · Parking
€€€€
Hilton Garden Inn Rochester Downtown, NY
Hôtel
3-étoile
1 lit king
Piscine · Animaux de compagnie acceptés · Cuisine ou coin cuisine
€€€€
The Strathallan - a DoubleTree by Hilton
Hôtel
4-étoile
1 lit king
Jardin · Piscine · Cuisine ou coin cuisine
€€€€
Courtyard Rochester Brighton
Hôtel
3-étoile
1 lit king
Piscine · Cuisine ou coin cuisine · Climatisation
€€€€
Holiday Inn Express Rochester - University Area, an IHG Hotel
Hôtel
3-étoile
1 single bed
Piscine · Cuisine ou coin cuisine · Climatisation
€€€€
Airport, Eastman Dental, UofR & Medical Ctr at Strong Hospital-Professionals Welcomed
Chambre d’hôte
Cuisine ou coin cuisine · Climatisation · Internet/Wi-Fi
€€€€
Convenient, Pet-Friendly Rochester Vacation Rental
Maison
Animaux de compagnie acceptés · Cuisine ou coin cuisine · Climatisation
€€€€
1bed-equippedkitchendttvhighfalls-wifi
Appartement
Animaux de compagnie acceptés · Cuisine ou coin cuisine · Climatisation
€€€€
1bedequippedkitchen-highfalls,tv,dt-wi-fi
Maison
Animaux de compagnie acceptés · Cuisine ou coin cuisine · Climatisation
€€€€
Studio Near Down-town_HighFall_Queenbed-Wi-Fi
Appartement
Animaux de compagnie acceptés
€€€€
ABODES ApartHotel
Appartement
Animaux de compagnie acceptés · Cuisine ou coin cuisine · Climatisation
€€€€
Charming Family Retreat- Cozy Comfort Awaits You! home
Maison
Cuisine ou coin cuisine · Climatisation · Internet/Wi-Fi
€€€€
Apartment Near UofR Strong Airport and DWTN
Appartement
Cuisine ou coin cuisine · Climatisation · Internet/Wi-Fi
€€€€
Home Theater Suite in Park Ave Neighborhood
Appartement
Jardin · Animaux de compagnie acceptés · Cuisine ou coin cuisine
€€€€
Hampton Inn & Suites Rochester Downtown
Hôtel
3-étoile
1 lit king
Piscine · Cuisine ou coin cuisine · Parking
€€€€
Nouveau sur VacationRenter
Beautifully Renovated 4B Single Family Brighton Sleeps 9 Pets Welcome
Maison
Jardin · Animaux de compagnie acceptés · Cuisine ou coin cuisine
€€€€
NY Style Centric Loft with King Bed by Park ave
Appartement
Animaux de compagnie acceptés · Cuisine ou coin cuisine · Climatisation
€€€€
Nouveau sur VacationRenter
Brighton 5th Floor Condo with Resort Amenities
Appartement
Piscine · Animaux de compagnie acceptés · Cuisine ou coin cuisine
€€€€